PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa017077
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 166aa    MW: 19007.5 Da    PI: 9.3566
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58673187PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.5e-182276256
               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               rk+ ++tkeq   Lee F+++++++ +++  LA++l+L  rqV vWFqNrRa+ k
  Lsa017077 22 RKKLRLTKEQSAFLEESFKEHNTLNPKQKLVLANQLNLRPRQVEVWFQNRRARTK 76
               678899***********************************************98 PP

2HD-ZIP_I/II128.82.2e-4122112192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  +kk+rl+keq+++LEesF+e+++L+p++K  la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l+een+rL+ke +eLr +lk
    Lsa017077  22 RKKLRLTKEQSAFLEESFKEHNTLNPKQKLVLANQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKTCCETLTEENRRLQKELQELR-ALK 112
                  69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.84E-191479IPR009057Homeodomain-like
PROSITE profilePS5007116.4551878IPR001356Homeobox domain
SMARTSM003891.0E-142082IPR001356Homeobox domain
CDDcd000864.56E-142279No hitNo description
PfamPF000466.3E-162276IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.0E-172281IPR009057Homeodomain-like
PROSITE patternPS0002705376IPR017970Homeobox, conserved site
SMARTSM003401.9E-2578121IPR003106Leucine zipper, homeobox-associated
PfamPF021835.4E-1178112IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
RVSSRRGGYV GTSDEDENGL GRKKLRLTKE QSAFLEESFK EHNTLNPKQK LVLANQLNLR  60
PRQVEVWFQN RRARTKLKQT EVDCEYLKTC CETLTEENRR LQKELQELRA LKTSQPFYMQ  120
HPATTLTMCP SCERVVTTTS TTTPASKPTT TTTAVLQQTT SDCPSH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17078RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010265939.11e-80PREDICTED: homeobox-leucine zipper protein HOX11-like
RefseqXP_015969427.12e-81PREDICTED: homeobox-leucine zipper protein HOX11
SwissprotA2Z1U12e-75HOX11_ORYSI; Homeobox-leucine zipper protein HOX11
SwissprotQ67UE28e-75HOX11_ORYSJ; Homeobox-leucine zipper protein HOX11
TrEMBLA0A068URD45e-83A0A068URD4_COFCA; Uncharacterized protein
STRINGPOPTR_0016s05890.13e-78(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-73homeobox from Arabidopsis thaliana